Cat#:RPH-NP003;Product Name:Recombinant Human 4-1BB Ligand / 4-1BBL / TNFSF9 / CD137L Protein;Synonym:Tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, 4-1BBL, TNFSF9.;Description:Recombinant Human 4-1BB ligand Protein is produced in E.coli and the target gene encoding Arg71-Glu254 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELV VAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGF QGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSELEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human 4-1BB Ligand/4-1BBL/TNFSF9/CD137L Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.;Stability:Recombinant Human 4-1BB Ligand/4-1BBL/TNFSF9/CD137L Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human 4-1BBL protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human 4-1BBL protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted 4-1BBL protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;