Cat#:FPA-49869P;Product Name:Rabbit Anti-ZNF793 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within aa 288-337 ( CGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGER ) of Human ZNF793 (NP_001013681). Run BLAST with Run BLAST with;Species Reactivity:Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Immunogen affinity purified;Storage Procedures:Preservative: None Constituents: 2% Sucrose, PBS;
Synthetic peptide corresponding to a region within aa 288-337 ( CGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGER ) of Human ZNF793 (NP_001013681). Run BLAST with Run BLAST with
Species Reactivity:
Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig