• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZNF793 Polyclonal Antibody Online Inquiry

Cat#:FPA-49869P
Product Name:Rabbit Anti-ZNF793 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide corresponding to a region within aa 288-337 ( CGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGER ) of Human ZNF793 (NP_001013681). Run BLAST with Run BLAST with
Species Reactivity: Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype: IgG
Application: WB
Storage Buffer: Immunogen affinity purified
Storage Procedures: Preservative: None Constituents: 2% Sucrose, PBS

Online Inquiry

refresh