Cat#:FPA-45742P;Product Name:Rabbit Anti-ZNF793 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human ZNF793 aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: KDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLASVGYEGTKPDVILRL ;Species Reactivity:Human Predicted to work with: Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human ZNF793 aa 11-60 (N terminal). The exact sequence is proprietary. Sequence: KDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLASVGYEGTKPDVILRL
Species Reactivity:
Human Predicted to work with: Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.