Cat#: | FPA-48898P |
Product Name: | Rabbit Anti-TOB2 Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Recombinant fragment corresponding to Human TOB2 aa 202-234. Sequence: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS Database link: Q14106 Run BLAST with Run BLAST with |
Species Reactivity: | Human Predicted to work with: Mouse |
Isotype: | IgG |
Application: | IHC-P |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol |