Cat#:FPA-42371P;Product Name:Rabbit Anti-TOB2 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TOB2 aa 41-90 (internal sequence). The exact sequence is proprietary. Sequence: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 2% Sucrose, 98% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human TOB2 aa 41-90 (internal sequence). The exact sequence is proprietary. Sequence: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 2% Sucrose, 98% PBS
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.