Cat#: | FPA-48829P |
Product Name: | Rabbit Anti-TMEM176A Polyclonal Antibody |
Formulation: | Liquid |
Host Species: | Rabbit |
Immunogen: | Synthetic peptide corresponding to a region within internal aa 143-192 ( GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ ) of Human TMEM176A (NP_060957). Run BLAST with Run BLAST with |
Species Reactivity: | Human |
Isotype: | IgG |
Application: | WB |
Storage Buffer: | Immunogen affinity purified |
Storage Procedures: | Preservative: None Constituents: 2% Sucrose, PBS |