Cat#:FPA-42109P;Product Name:Rabbit Anti-TMEM176A Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human TMEM176A aa 1-50 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGS ;Species Reactivity:Mouse, Rat, Human;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 0.01% BSA Aqueous buffered solution;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;