Cat#:FPA-42610P;Product Name:Rabbit Anti-Transaldolase 1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human Transaldolase 1 aa 189-263. Sequence: FVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASF RNTGEIKALAGCDFLTISPKLLGEL ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Chinese hamster;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;