Cat#:FPA-42609P;Product Name:Rabbit Anti-Transaldolase 1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Transaldolase 1 aa 267-317. The exact sequence is proprietary. Sequence: NAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFA A ;Species Reactivity:Mouse, Human Predicted to work with: Chimpanzee, Gorilla;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;