Cat#:RPH-NP301;Product Name:Recombinant Human OX40 Ligand / TNFSF4 / OX40L Protein;Synonym:Tumor necrosis factor ligand superfamily member 4,Glycoprotein Gp34,OX40 ligand,OX40L,TAX transcriptionally-activated glycoprotein 1,TNFSF4,CD252,TXGP1;Description:Recombinant Human OX40 Ligand Protein is produced in Human Cells and the target gene encoding Gln51-Leu183 is expressed with a His tag at the N-terminus.;Source:Human Cells;AA Sequence:HHHHHHQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYF SQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIH QNPGEFCVL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human OX40 Ligand/TNFSF4/OX40L Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.;Stability:Recombinant Human OX40 Ligand/TNFSF4/OX40L Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TNFSF4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human TNFSF4 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TNFSF4 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human OX40 Ligand Protein is produced in Human Cells and the target gene encoding Gln51-Leu183 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human OX40 Ligand/TNFSF4/OX40L Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Stability:
Recombinant Human OX40 Ligand/TNFSF4/OX40L Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human TNFSF4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human TNFSF4 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TNFSF4 protein samples are stable below -20°C for 3 months.