Cat#:RPH-NP300;Product Name:Recombinant Human Ornithine Decarboxylase / ODC1 Protein;Synonym:Ornithine decarboxylase, ODC1,;Description:Recombinant Human Ornithine decarboxylase Protein is produced in E.coli and the target gene encoding Met1-Val461 is expressed with a T7 tag at the N-terminus, His tag at the C-terminus.;Source:E. coli;AA Sequence:MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKK HLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQ VSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLL ERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKL KFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSE QTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMH VGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSC AWESGMKRHRAACASASINVLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Ornithine Decarboxylase/ODC1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl, pH 8.0.;Stability:Recombinant Human Ornithine Decarboxylase/ODC1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Ornithine Decarboxylase/ODC1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Ornithine Decarboxylase / ODC1 Protein
Online Inquiry
Cat#:
RPH-NP300
Product Name:
Recombinant Human Ornithine Decarboxylase / ODC1 Protein
Synonym:
Ornithine decarboxylase, ODC1,
Description:
Recombinant Human Ornithine decarboxylase Protein is produced in E.coli and the target gene encoding Met1-Val461 is expressed with a T7 tag at the N-terminus, His tag at the C-terminus.