Cat#:RPH-NP177;Product Name:Recombinant Human Heparin Binding EGF like Growth Factor / proHB-EGF Protein;Synonym:Diphtheria toxin receptor; DTR;HEGFL; heparin-binding EGF-like growth factor; DTS; DTSF; heparin-binding epidermal growth factor; proheparin-binding EGF-like growth factor; HB-EGF; pro HB-EGF;Description:Recombinant Human Heparin Binding EGF like Growth Factor Protein is produced in Human Cells and the target gene encoding Leu20-Leu148 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALA TPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLH HHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human Heparin Binding EGF like Growth Factor/proHB-EGF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH4O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human proHB-EGF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human proHB-EGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human proHB-EGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;