Cat#:RPH-NP176;Product Name:Recombinant Human Heme Oxygenase 1 / HO-1 Protein;Synonym:Heme Oxygenase 1, HO-1, HMOX1, HO, HO1;Description:Recombinant Human Heme Oxygenase 1 Protein is produced in E.coli and the target gene encoding Met1-Thr261 is expressed.;Source:E.coli;AA Sequence:MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEI ERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLV AHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAV RQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLN T;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Heme Oxygenase 1/HO-1 Protein was supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.;Stability:Recombinant Human Heme Oxygenase 1/HO-1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Heme Oxygenase 1/HO-1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;