Cat#:RP-PLCG1H;Product Name:Recombinant Human PLCG1 Protein(GST Tag);Synonym:PLCG1; PLC-II; PLCgamma 1; PLC1; PLC148; NCKAP3; phospholipase C gamma 1;Background:The full name of PLCG1 gene is phospholipase C gamma 1, also known as PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1. The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators.Gene ID: 5335. The PLCG1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, rat, chicken, zebrafish, fruit fly, mosquito, C.elegans, and A.thaliana.;Description:Recombinant Human PLCG1 Protein (1192 a.a. - 1291 a.a.)expressed in wheat germ was fused with GST tag at N terminal.The PLCG1 protein has the MW of 36.74 kDa. ;Source:Wheat Germ;AA Sequence:LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL;Molecular Characterization:36.74 kDa;Purity:2.5% by SDS-PAGE Stained with Coomassie Blue.;Host Species:Human;Application:ELISA, WB, Protein Array, Antibody production as immunogen ;Storage Buffer:50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.;Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.;Usage:For Lab Research Use Only;References:Phospholipase Cγ in Toll-like receptor-mediated inflammation and innate immunity. Bae YS, et al. Adv Biol Regul, 2017 Jan. PMID 27707630;