Cat#:RP-13095H;Product Name:Recombinant Human PLCG1 Protein(GST Tag);Background:The full name of PLCG1 gene is phospholipase C gamma 1, also known as PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1. The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators.Gene ID: 5335. The PLCG1 gene is conserved in chimpanzee, Rhesus monkey, dog, cow, mouse, rat, chicken, zebrafish, fruit fly, mosquito, C.elegans, and A.thaliana.;Description:Recombinant Human PLCG1 Protein (1192 a.a. - 1291 a.a.)expressed in wheat germ was fused with GST tag at N terminal.;Source:E. coli;AA Sequence:MAEGSAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAGRDGRH ;Purity:95%, by SDS-PAGE with Coomassie Brilliant Blue staining.;Formulation:Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.;Stability:Recombinant human PLCG1 Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Host Species:Human;Storage:Store human PLCG1 protein at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;References:PLCG1 Gene Mutations Are Uncommon in Cutaneous T-Cell Lymphomas. Caumont C, et al. J Invest Dermatol, 2015 Sep.;