• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human PCNA Protein, His Tag Online Inquiry

  • Cat#:
  • RP-12800H
  • Product Name:
  • Recombinant Human PCNA Protein, His Tag
  • Source:
  • E. coli
  • AA Sequence:
  • QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE
  • Purity:
  • 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
  • Formulation:
  • Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  • Storage:
  • Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human PCNA Protein, GST Tag-Advanced Biomart
  • Online Inquiry

    refresh