Cat#:RPH-NP295;Product Name:Recombinant Human NGAL / Lipocalin-2 / LCN2 Protein;Synonym:Neutrophil gelatinase-associated lipocalin, NGAL, 25 kDa alpha-2-microglobulin-related subunit of MMP-9, Lipocalin-2, Oncogene 24p3, Siderocalin LCN2, p25, HNL, NGAL;Description:Recombinant Human NGAL Protein is produced in Human Cells and the target gene encoding Gln21-Gly198 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYN VTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNR EYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human NGAL/Lipocalin-2/LCN2 Protein was supplied as a 0.2 μm filtered solution of PBS, 50% glycerol,pH7.4.;Stability:Recombinant Human NGAL/Lipocalin-2/LCN2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human NGAL/Lipocalin-2/LCN2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;