Cat#:RPH-NP294;Product Name:Recombinant Human NCR3 / NKp30 / CD337 Protein;Synonym:Natural Cytotoxicity Triggering Receptor 3, Activating Natural Killer Receptor p30, Natural Killer Cell p30-Related Protein, NK-p30, NKp30, CD337, NCR3, 1C7, LY117;Description:Recombinant Human NCR3 Protein is produced in Human Cells and the target gene encoding Leu19-Thr138 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASS RFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human NCR3/NKp30/CD337 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human NCR3/NKp30/CD337 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human NCR3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human NCR3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human NCR3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human NCR3/NKp30/CD337 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human NCR3/NKp30/CD337 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human NCR3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human NCR3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human NCR3 protein samples are stable below -20°C for 3 months.