Cat#:RPH-NP291;Product Name:Recombinant Human Methionine Aminopeptidase 1D / MetAP1D / MAP1D (N, C-His);Synonym:Methionine Aminopeptidase 1D Mitochondrial, Methionyl Aminopeptidase Type 1D Mitochondrial, METAP1D, MAP1D;Description:Recombinant Human MetAP1D Protein is produced in E.coli and the target gene encoding Arg44-Ala335 is expressed with a His tag at the N-terminus, His tag at the C-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIE VKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVC TSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEA IAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFT IEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEALEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Methionine Aminopeptidase 1D/MetAP1D/MAP1D (N, C-His)was supplied as a 0.2 μm filtered solution of 50mM Tris, 100mM NaCl, pH 8.0.;Stability:Recombinant Human Methionine Aminopeptidase 1D/MetAP1D/MAP1D (N, C-His)is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Methionine Aminopeptidase 1D/MetAP1D/MAP1D protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;