Cat#:RPH-NP292;Product Name:Recombinant Human Methylmalonyl-CoA Epimerase / MCEE Protein;Synonym:Methylmalonyl-CoA epimerase, mitochondrial,DL-methylmalonyl-CoA racemase;Description:Recombinant Human Methylmalonyl-CoA epimerase Protein is produced in Human Cells and the target gene encoding Gln37-Ala176 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHP LGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDC GGVLVELEQALDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol,pH7.5.;Stability:Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Methylmalonyl-CoA epimerase Protein is produced in Human Cells and the target gene encoding Gln37-Ala176 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol,pH7.5.
Stability:
Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Methylmalonyl-CoA Epimerase/MCEE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.