Cat#:RPH-NP278;Product Name:Recombinant Human L-Lactate Dehydrogenase B Chain / LDH-B Protein;Synonym:L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46, LDHB;Description:Recombinant Human LDH-B Protein is produced in E.coli and the target gene encoding Met1-Leu334 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSL ADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNL VQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLM AEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVI NQKLKDDEVAQLKKSADTLWDIQKDLKDL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.;Stability:Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Stability:
Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human L-Lactate Dehydrogenase B Chain/LDH-B Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.