Cat#:RPH-NP277;Product Name:Recombinant Human L-Lactate Dehydrogenase A Chain / LDH-A / PIG19 Protein;Synonym:L-Lactate Dehydrogenase A Chain, LDH-A, Cell Proliferation-Inducing Gene 19 Protein, LDH Muscle Subunit, LDH-M, Renal Carcinoma Antigen NY-REN-59, LDHA;Description:Recombinant Human LDH-A Protein is produced in E.coli and the target gene encoding Met1-Phe332 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLA DELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLV QRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMG ERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVK VTLTSEEEARLKKSADTLWGIQKELQF;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.;Stability:Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.
Stability:
Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human L-Lactate Dehydrogenase A Chain/LDH-A/PIG19 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.