• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human KIR2DL3 / NKAT2 / CD158b2 Protein Online Inquiry

  • Cat#:
  • RPH-NP263
  • Product Name:
  • Recombinant Human KIR2DL3 / NKAT2 / CD158b2 Protein
  • Synonym:
  • Killer Cell Immunoglobulin-Like Receptor 2DL3, CD158 Antigen-Like Family Member B2, KIR-023GB, Killer Inhibitory Receptor cl 2-3, MHC Class I NK Cell Receptor, NKAT2a, NKAT2b, Natural Killer-Associated Transcript 2, NKAT-2, p58 Natural Killer Cell Receptor Clone CL-6, p58 NK Receptor CL-6, p58.2 MHC Class-I-Specific NK Receptor, CD158b2, KIR2DL3, CD158B2, KIRCL23, NKAT2
  • Description:
  • Recombinant Human KIR2DL3 Protein is produced in Human Cells and the target gene encoding His22-His245 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFS IGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSS RSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPL LVSVTGNPSNSWLSPTEPSSETGNPRHLHHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human KIR2DL3/NKAT2/CD158b2 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
  • Stability:
  • Recombinant Human KIR2DL3/NKAT2/CD158b2 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human KIR2DL3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human KIR2DL3 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human KIR2DL3 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human KHK Protein I Advanced Biomart
  • Online Inquiry

    refresh