Cat#:RPH-NP262;Product Name:Recombinant Human Ketohexokinase / KHK Protein;Synonym:Ketohexokinase, Hepatic fructokinase,KHK;Description:Recombinant Human Ketohexokinase Protein is produced in Human Cells and the target gene encoding Met1-Val298 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Ketohexokinase/KHK Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4.;Stability:Recombinant Human Ketohexokinase/KHK Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombiant human KHK protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Ketohexokinase / KHK Protein
Online Inquiry
Cat#:
RPH-NP262
Product Name:
Recombinant Human Ketohexokinase / KHK Protein
Synonym:
Ketohexokinase, Hepatic fructokinase,KHK
Description:
Recombinant Human Ketohexokinase Protein is produced in Human Cells and the target gene encoding Met1-Val298 is expressed with a His tag at the C-terminus.