Cat#:RPH-NP186;Product Name:Recombinant Human IL2 Receptor Subunit β / IL2RB / CD122 Protein;Synonym:Interleukin-2 receptor subunit beta,IL2RB,IL-2 receptor subunit beta,IL-2R subunit beta,High affinity IL-2 receptor subunit beta,CD122;Description:Recombinant Human IL-2 receptor beta Protein is produced in Human Cells and the target gene encoding Ala27-Asp239 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILG APDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQ ASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWS PWSQPLAFRTKPAALGKDVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human IL2 Receptor Subunit β/IL2RB/CD122 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human IL2 Receptor Subunit β/IL2RB/CD122 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IL2RB protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL2RB protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL2RB protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human IL-2 receptor beta Protein is produced in Human Cells and the target gene encoding Ala27-Asp239 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human IL2 Receptor Subunit β/IL2RB/CD122 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Stability:
Recombinant Human IL2 Receptor Subunit β/IL2RB/CD122 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IL2RB protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IL2RB protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IL2RB protein samples are stable below -20°C for 3 months.