Cat#:RPH-NP185;Product Name:Recombinant Human IGF2 mRNA-Binding Protein 2 / IGF2BP2 / IMP2 Protein;Synonym:Insulin-Like Growth Factor 2 mRNA-Binding Protein 2, IGF2 mRNA-Binding Protein 2, IMP-2, Hepatocellular Carcinoma Autoantigen p62, IGF-II mRNA-Binding Protein 2, VICKZ Family Member 2, IGF2BP2, IMP2, VICKZ2;Description:Recombinant Human IGF2BP2 Protein is produced in E.coli and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus, His tag at the C-terminus.;Source:E. coli;AA Sequence:MASMTGGQQMGRGSEFMMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQN WAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQV NTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQ GHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human IGF2BP2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IGF2BP2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IGF2BP2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human IGF2 mRNA-Binding Protein 2 / IGF2BP2 / IMP2 Protein
Online Inquiry
Cat#:
RPH-NP185
Product Name:
Recombinant Human IGF2 mRNA-Binding Protein 2 / IGF2BP2 / IMP2 Protein
Synonym:
Insulin-Like Growth Factor 2 mRNA-Binding Protein 2, IGF2 mRNA-Binding Protein 2, IMP-2, Hepatocellular Carcinoma Autoantigen p62, IGF-II mRNA-Binding Protein 2, VICKZ Family Member 2, IGF2BP2, IMP2, VICKZ2
Description:
Recombinant Human IGF2BP2 Protein is produced in E.coli and the target gene encoding Met1-Thr220 is expressed with a T7 tag at the N-terminus, His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human IGF2 mRNA-Binding Protein 2/IGF2BP2/IMP2 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human IGF2BP2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human IGF2BP2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human IGF2BP2 protein samples are stable below -20°C for 3 months.