Cat#:RPH-NP259;Product Name:Recombinant Human Isocitrate Dehydrogenase 1 / IDH1 Protein;Synonym:Isocitrate Dehydrogenase [NADP] Cytoplasmic, IDH, Cytosolic NADP-Isocitrate Dehydrogenase, IDP, NADP(+)-Specific ICDH, Oxalosuccinate Decarboxylase, IDH1, PICD;Description:Recombinant Human Isocitrate Dehydrogenase Protein is produced in Human Cells and the target gene encoding Met1-Leu414 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIK KHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHS SFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMK SEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQET STNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSD YLNTFEFMDKLGENLKIKLAQAKLVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Isocitrate Dehydrogenase 1/IDH1 Protein was supplied as a 0.2 μm filtered solution of PBS.;Stability:Recombinant Human Isocitrate Dehydrogenase 1/IDH1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombiant human IDH1 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Isocitrate Dehydrogenase Protein is produced in Human Cells and the target gene encoding Met1-Leu414 is expressed with a His tag at the C-terminus.