Cat#:RPH-NP258;Product Name:Recombinant Human Isocitrate Dehydrogenase 1 / IDH1 (R132H, C-8His);Synonym:Isocitrate Dehydrogenase [NADP] Cytoplasmic, IDH, Cytosolic NADP-Isocitrate Dehydrogenase, IDP, NADP(+)-Specific ICDH, Oxalosuccinate Decarboxylase, IDH1, PICD;Description:Recombinant Human Isocitrate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Leu414 is expressed with a 8His tag at the C-terminus.;Source:E.coli;AA Sequence:MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIK KHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHS SFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMK SEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQET STNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSD YLNTFEFMDKLGENLKIKLAQAKLSLEHHHHHHHH;Purity:Greater than 94% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg).;Formulation:Recombinant Human Isocitrate Dehydrogenase 1/IDH1 (R132H, C-8His)was supplied as a 0.2 μm filtered solution of 50mM Tris, 200mM NaCl, 10% glycerol, pH8.0.;Stability:Recombinant Human Isocitrate Dehydrogenase 1/IDH1 (R132H, C-8His)is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombiant human IDH1 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Isocitrate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Leu414 is expressed with a 8His tag at the C-terminus.