• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Isocitrate Dehydrogenase 1 / IDH1 (R132H, C-8His) Online Inquiry

  • Cat#:
  • RPH-NP258
  • Product Name:
  • Recombinant Human Isocitrate Dehydrogenase 1 / IDH1 (R132H, C-8His)
  • Synonym:
  • Isocitrate Dehydrogenase [NADP] Cytoplasmic, IDH, Cytosolic NADP-Isocitrate Dehydrogenase, IDP, NADP(+)-Specific ICDH, Oxalosuccinate Decarboxylase, IDH1, PICD
  • Description:
  • Recombinant Human Isocitrate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Leu414 is expressed with a 8His tag at the C-terminus.
  • Source:
  • E.coli
  • AA Sequence:
  • MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIK KHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHS SFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMK SEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQET STNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSD YLNTFEFMDKLGENLKIKLAQAKLSLEHHHHHHHH
  • Purity:
  • Greater than 94% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg).
  • Formulation:
  • Recombinant Human Isocitrate Dehydrogenase 1/IDH1 (R132H, C-8His)was supplied as a 0.2 μm filtered solution of 50mM Tris, 200mM NaCl, 10% glycerol, pH8.0.
  • Stability:
  • Recombinant Human Isocitrate Dehydrogenase 1/IDH1 (R132H, C-8His)is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store recombiant human IDH1 protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human Interleukin-9 I IL9 I Cytokine P40 Protein I Advanced Biomart
  • Online Inquiry

    refresh