Cat#:RPH-NP157;Product Name:Recombinant Human Glia Maturation Factor β / GMF-β / GMFB Protein;Synonym:Glia maturation factor beta,GMF-beta, GMFB;Description:Recombinant Human Glia maturation factor beta Protein is produced in E.coli and the target gene encoding Met1-His142 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQ PRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLT EEWLREKLGFFHLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mMNaCl,pH8.0.;Stability:Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Glia Maturation Factor β / GMF-β / GMFB Protein
Online Inquiry
Cat#:
RPH-NP157
Product Name:
Recombinant Human Glia Maturation Factor β / GMF-β / GMFB Protein
Synonym:
Glia maturation factor beta,GMF-beta, GMFB
Description:
Recombinant Human Glia maturation factor beta Protein is produced in E.coli and the target gene encoding Met1-His142 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mMNaCl,pH8.0.
Stability:
Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human Glia Maturation Factor β/GMF-β/GMFB Protein samples are stable below -20°C for 3 months.