Cat#:RPH-NP156;Product Name:Recombinant Human GITR / TNFRSF18 / CD357 Protein;Synonym:Tumor necrosis factor receptor superfamily member 18, TNFRSF18, Glucocorticoid-induced TNFR-related protein, CD357, TNFRSF18, AITR, GITR;Description:Recombinant Human GITR Protein is produced in Human Cells and the target gene encoding Gln26-Gln161 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCR HHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVP GSPPAEIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human GITR/TNFRSF18/CD357 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human GITR/TNFRSF18/CD357 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human GITR/TNFRSF18/CD357 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human GITR protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human GITR protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;