Cat#:RPH-NP141;Product Name:Recombinant Human Fibroblast Growth Factor 8 / FGF8e Protein;Synonym:Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B, REF: C1014;Description:Recombinant Human Fibroblast growth factor 8e Protein is produced in E.coli and the target gene encoding Gln23-Arg233 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSR RLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKK GKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRL PRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 8/FGF8e Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.;Stability:Recombinant Human Fibroblast Growth Factor 8/FGF8e Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF8e protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF8e protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF8e protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Fibroblast growth factor 8e Protein is produced in E.coli and the target gene encoding Gln23-Arg233 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fibroblast Growth Factor 8/FGF8e Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.
Stability:
Recombinant Human Fibroblast Growth Factor 8/FGF8e Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human FGF8e protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF8e protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF8e protein samples are stable below -20°C for 3 months.