• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Fibroblast Growth Factor 8 / FGF8a Protein Online Inquiry

  • Cat#:
  • RPH-NP140
  • Product Name:
  • Recombinant Human Fibroblast Growth Factor 8 / FGF8a Protein
  • Synonym:
  • Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B, REF: C1013
  • Description:
  • Recombinant Human Fibroblast growth factor 8a Protein is produced in E.coli and the target gene encoding Gln23-Arg204 is expressed with a His tag at the N-terminus.
  • Source:
  • E.coli
  • AA Sequence:
  • MGSSHHHHHHSSGLVPRGSHMQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMA EDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQ NAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQ RTWAPEPR
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Fibroblast Growth Factor 8/FGF8a Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.
  • Stability:
  • Recombinant Human Fibroblast Growth Factor 8/FGF8a Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human FGF8a protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF8a protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF8a protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human FGF7 Protein I Advanced Biomart
  • Online Inquiry

    refresh