Cat#:RPH-NP138;Product Name:Recombinant Human Fibroblast Growth Factor 7 / FGF7 / KGF Protein;Synonym:Fibroblast growth factor 7,FGF-7,Heparin-binding growth factor 7,HBGF-7,Keratinocyte growth factor,FGF7,KGF;Description:Recombinant Human Fibroblast Growth Factor 7 Protein is produced in E.coli and the target gene encoding Cys32-Thr194 is expressed.;Source:E. coli;AA Sequence:CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYN IMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGG EMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 7/FGF7/KGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,pH8.0,l50mM NaCl.;Stability:Recombinant Human Fibroblast Growth Factor 7/FGF7/KGF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF7 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF7 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human KGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;