Cat#:RPH-NP137;Product Name:Recombinant Human Fibroblast Growth Factor 6 / FGF6 Protein;Synonym:Fibroblast Growth Factor 6, FGF-6, Heparin Secretory-Transforming Protein 2, HST-2, HSTF-2, Heparin-Binding Growth Factor 6, HBGF-6, FGF6, HST2, HSTF2;Description:Recombinant Human Fibroblast Growth Factor 6 Protein is produced in E.coli and the target gene encoding Gly41-Ile208 is expressed.;Source:E.coli;AA Sequence:GTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGR ISGTHEENPYSLLEISTVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNA YESDLYQGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 6/FGF6 Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,pH8.0.;Stability:Recombinant Human Fibroblast Growth Factor 6/FGF6 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF6 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF6 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF6 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;