Cat#:RPH-NP123;Product Name:Recombinant Human Fetuin-A / AHSG / α-2-HS-Glycoprotein / AHSG Protein;Synonym:Alpha-2-HS-Glycoprotein, Alpha-2-Z-Globulin, Ba-Alpha-2-Glycoprotein, Fetuin-A, AHSG, FETUA;Description:Recombinant Human Fetuin A Protein is produced in Human Cells and the target gene encoding Ala19-Val367 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEID TLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQD CPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEA TEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAP PSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVV QPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fetuin-A/AHSG/α-2-HS-GlycoProtein /AHSG Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.;Stability:Recombinant Human Fetuin-A/AHSG/α-2-HS-GlycoProtein /AHSG Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized human AHSG protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human AHSG protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human AHSG samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fetuin-A/AHSG/α-2-HS-GlycoProtein /AHSG Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Stability:
Recombinant Human Fetuin-A/AHSG/α-2-HS-GlycoProtein /AHSG Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized human AHSG protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human AHSG protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human AHSG samples are stable below -20°C for 3 months.