Cat#:RPH-NP122;Product Name:Recombinant Human Fatty Acid-Binding Protein 4 / FABP4 / A-FABP / aP2 Protein;Synonym:Fatty Acid-Binding Protein Adipocyte, Adipocyte Lipid-Binding Protein, ALBP, Adipocyte-Type Fatty Acid-Binding Protein, A-FABP, AFABP, Fatty Acid-Binding Protein 4;Description:Recombinant Human FABP4 Protein is produced in E.coli and the target gene encoding Cys2-Ala132 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISV NGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKRE DDKLVVECVMKGVTSTRVYERA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fatty Acid-Binding Protein 4/FABP4/A-FABP/aP2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Fatty Acid-Binding Protein 4/FABP4/A-FABP/aP2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FABP4 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human FABP4 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human FABP4 samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fatty Acid-Binding Protein 4/FABP4/A-FABP/aP2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human Fatty Acid-Binding Protein 4/FABP4/A-FABP/aP2 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human FABP4 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human FABP4 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human FABP4 samples are stable below -20°C for 3 months.