Cat#:RPH-NP119;Product Name:Recombinant Human Esterase D Protein;Synonym:S-Formylglutathione Hydrolase, FGH, Esterase D, Methylumbelliferyl-Acetate Deacetylase, ESD;Description:Recombinant Human Esterase D Protein is produced in E.coli and the target gene encoding Met1-Ala282 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKS GYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQ LINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTD QSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDH SYYFIATFITDHIRHHAKYLNALEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Esterase D Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.;Stability:Recombinant Human Esterase D Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Esterase D Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;