Cat#:RPH-NP118;Product Name:Recombinant Human Epidermal Growth Factor / EGF Protein;Synonym:Pro-Epidermal Growth Factor, EGF, Epidermal Growth Factor, Urogastrone;Description:Recombinant Human Epidermal Growth Factor Protein is produced in E.coli and the target gene encoding Asn971-Arg1023 is expressed.;Source:E. coli;AA Sequence:NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 2 ng/ml.;Formulation:Recombinant Human Epidermal Growth Factor/EGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 7.0.;Stability:Recombinant Human Epidermal Growth Factor/EGF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human EGF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human EGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human EGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
ED50 is less than 2 ng/ml.
Formulation:
Recombinant Human Epidermal Growth Factor/EGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 7.0.
Stability:
Recombinant Human Epidermal Growth Factor/EGF Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human EGF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human EGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human EGF protein samples are stable below -20°C for 3 months.