Cat#:RPH-NP098;Product Name:Recombinant Human C-X-C Motif Chemokine 4 / CXCL4 / PF4 Protein;Synonym:Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A, PF4, CXCL4, SCYB4;Description:Recombinant Human C-X-C Motif Chemokine 4 Protein is produced in E.coli and the target gene encoding Glu32-Ser101 is expressed.;Source:E.coli;AA Sequence:EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLES;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is 5-15 μg/mL.;Formulation:Recombinant Human C-X-C Motif Chemokine 4/CXCL4/PF4 Protein was lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, pH 8.0.;Stability:Recombinant Human C-X-C Motif Chemokine 4/CXCL4/PF4 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human CXCL4 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CXCL4 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;