Cat#:RPH-NP097;Product Name:Recombinant Human C-X-C Motif Chemokine 3 / CXCL3 / GROγ Protein;Synonym:C-X-C Motif Chemokine 3, GRO-Gamma (1-73), Growth-Regulated Protein Gamma, GRO-Gamma, Macrophage Inflammatory Protein 2-Beta, MIP2-Beta, GRO-Gamma (5-73), CXCL3, GRO3, GROG, SCYB3;Description:Recombinant Human C-X-C Motif Chemokine 3 Protein is produced in E.coli and the target gene encoding Ala35-Asn107 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATL KNGKKACLNPASPMVQKIIEKILNKGSTN;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-X-C Motif Chemokine 3/CXCL3/GROγ Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human C-X-C Motif Chemokine 3/CXCL3/GROγ Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human CXCL3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CXCL3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;