Cat#:RPH-NP070;Product Name:Recombinant Human CD27 Ligand / TNFSF7 / CD70 Protein;Synonym:CD70,CD27 ligand,Tumor necrosis factor ligand superfamily member 7,CD27LG, TNFSF7;Description:Recombinant Human CD70 Protein is produced in Human Cells and the target gene encoding Gln45-Pro193 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQ VTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGT LLPSRNTDETFFGVQWVRPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.;Stability:Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TNFSF7 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD70 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.
Stability:
Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TNFSF7 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD70 protein samples are stable below -20°C for 3 months.