Cat#:RPH-NP071;Product Name:Recombinant Human CD27 / TNFRSF7 Protein;Synonym:CD27 antigen is also known as CD27L receptor, T-cell activation antigen CD27, Tumor necrosis factor receptor superfamily member 7, T14 and TNFRSF7.;Description:Recombinant Human CD27 Protein is produced in Human Cells and the target gene encoding Thr21-Ile192 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:TPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCR HCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSE MLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRIVDDIEGRMDEPKSCDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD27/TNFRSF7 Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.;Stability:Recombinant Human CD27/TNFRSF7 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD27 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human CD27 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;