Cat#:RPH-NP064;Product Name:Recombinant Human C-C Motif Chemokine 3-Like 1 / CCL3L1 Protein;Synonym:C-C Motif Chemokine 3-Like 1, G0/G1 Switch Regulatory Protein 19-2, LD78-Beta(1-70), PAT 464.2, Small-Inducible Cytokine A3-Like 1, Tonsillar Lymphocyte LD78 Beta Protein, CCL3L1, D17S1718, G0S19-2, SCYA3L1, CCL3L3;Description:Recombinant Human C-C Motif Chemokine 3-Like 1 Protein is produced in Human Cells and the target gene encoding Ala24-Ala93 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSD LEPSAVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:IN STOCK;Formulation:Recombinant Human C-C Motif Chemokine 3-Like 1/CCL3L1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human C-C Motif Chemokine 3-Like 1/CCL3L1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL3L1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL3L1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL3L1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;