Cat#:RPH-NP063;Product Name:Recombinant Human C-C Motif Chemokine 3 / CCL3 Protein;Synonym:C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-Alpha, MIP-1-Alpha, PAT 464.1, SIS-Beta, Small-Inducible Cytokine A3, Tonsillar Lymphocyte LD78 Alpha Protein, CCL3, G0S19-1, MIP1A, SCYA3;Description:Recombinant Human C-C Motif Chemokine 3 Protein is produced in E.coli and the target gene encoding Ser24-Ala92 is expressed.;Source:E.coli;AA Sequence:SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDL ELSA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is 3-10 ng/mL.;Formulation:Recombinant Human C-C Motif Chemokine 3/CCL3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human C-C Motif Chemokine 3/CCL3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
ED50 is 3-10 ng/mL.
Formulation:
Recombinant Human C-C Motif Chemokine 3/CCL3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human C-C Motif Chemokine 3/CCL3 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CCL3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL3 protein samples are stable below -20°C for 3 months.