Cat#:RPH-NP055;Product Name:Recombinant Human C-C Motif Chemokine 18 / CCL18 / PARC Protein;Synonym:C-C Motif Chemokine 18, Alternative Macrophage Activation-Associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-Regulated Chemokine, Small-Inducible Cytokine A18,CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18;Description:Recombinant Human C-C Motif Chemokine 18 Protein is produced in E.coli and the target gene encoding Ala21-Ala89 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTK RGRQICADPNKKWVQKYISDLKLNA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl,pH7.4.;Stability:Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL18 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL18 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL18 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human C-C Motif Chemokine 18 / CCL18 / PARC Protein
Online Inquiry
Cat#:
RPH-NP055
Product Name:
Recombinant Human C-C Motif Chemokine 18 / CCL18 / PARC Protein
Synonym:
C-C Motif Chemokine 18, Alternative Macrophage Activation-Associated CC Chemokine 1, AMAC-1, CC Chemokine PARC, Dendritic Cell Chemokine 1, DC-CK1, Macrophage Inflammatory Protein 4, MIP-4, Pulmonary and Activation-Regulated Chemokine, Small-Inducible Cytokine A18,CCL18, AMAC1, DCCK1, MIP4, PARC, SCYA18
Description:
Recombinant Human C-C Motif Chemokine 18 Protein is produced in E.coli and the target gene encoding Ala21-Ala89 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl,pH7.4.
Stability:
Recombinant Human C-C Motif Chemokine 18/CCL18/PARC Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CCL18 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL18 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL18 protein samples are stable below -20°C for 3 months.