• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human C-C Motif Chemokine 16 / CCL16 Protein Online Inquiry

  • Cat#:
  • RPH-NP054
  • Product Name:
  • Recombinant Human C-C Motif Chemokine 16 / CCL16 Protein
  • Synonym:
  • C-C Motif Chemokine 16, Chemokine CC-4, HCC-4, Chemokine LEC, IL-10-Inducible Chemokine, LCC-1, Liver-Expressed Chemokine, Lymphocyte and Monocyte Chemoattractant, LMC, Monotactin-1, MTN-1, NCC-4, Small-Inducible Cytokine A16, CCL16, ILINCK, NCC4, SCYA16
  • Description:
  • Recombinant Human C-C Motif Chemokine 16 Protein is produced in E.coli and the target gene encoding Gln24-Gln120 is expressed.
  • Source:
  • E.coli
  • AA Sequence:
  • QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYI KDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human C-C Motif Chemokine 16/CCL16 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Stability:
  • Recombinant Human C-C Motif Chemokine 16/CCL16 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human CCL16 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL16 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL16 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human CCL14 / HCC-3 Protein I Advanced Biomart
  • Online Inquiry

    refresh