Cat#:RPH-NP054;Product Name:Recombinant Human C-C Motif Chemokine 16 / CCL16 Protein;Synonym:C-C Motif Chemokine 16, Chemokine CC-4, HCC-4, Chemokine LEC, IL-10-Inducible Chemokine, LCC-1, Liver-Expressed Chemokine, Lymphocyte and Monocyte Chemoattractant, LMC, Monotactin-1, MTN-1, NCC-4, Small-Inducible Cytokine A16, CCL16, ILINCK, NCC4, SCYA16;Description:Recombinant Human C-C Motif Chemokine 16 Protein is produced in E.coli and the target gene encoding Gln24-Gln120 is expressed.;Source:E.coli;AA Sequence:QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYI KDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-C Motif Chemokine 16/CCL16 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human C-C Motif Chemokine 16/CCL16 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CCL16 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL16 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL16 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human C-C Motif Chemokine 16/CCL16 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human C-C Motif Chemokine 16/CCL16 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CCL16 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CCL16 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CCL16 protein samples are stable below -20°C for 3 months.