Cat#:RPH-NP033;Product Name:Recombinant Human B7-H2 / ICOSLG / CD275 Protein;Synonym:ICOS Ligand, B7 Homolog 2, B7-H2, B7-Like Protein Gl50, B7-Related Protein 1, B7RP-1, CD275, ICOSLG, B7H2, B7RP1, ICOSL, KIAA0653;Description:Recombinant Human Inducible Co-Stimulator Ligand Protein is produced in Human Cells and the target gene encoding Asp19-Ser258 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNR ALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHS PSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNI GCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human B7-H2/ICOSLG/CD275 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human B7-H2/ICOSLG/CD275 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human B7-H2 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human B7-H2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human B7-H2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human B7-H2 / ICOSLG / CD275 Protein
Online Inquiry
Cat#:
RPH-NP033
Product Name:
Recombinant Human B7-H2 / ICOSLG / CD275 Protein
Synonym:
ICOS Ligand, B7 Homolog 2, B7-H2, B7-Like Protein Gl50, B7-Related Protein 1, B7RP-1, CD275, ICOSLG, B7H2, B7RP1, ICOSL, KIAA0653
Description:
Recombinant Human Inducible Co-Stimulator Ligand Protein is produced in Human Cells and the target gene encoding Asp19-Ser258 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human B7-H2/ICOSLG/CD275 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human B7-H2/ICOSLG/CD275 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human B7-H2 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human B7-H2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human B7-H2 protein samples are stable below -20°C for 3 months.