Cat#:RPH-NP032;Product Name:Recombinant Human B7-2 / CD86 Protein;Synonym:T-Lymphocyte Activation Antigen CD86, Activation B7-2 Antigen, B70, BU63, CTLA-4 Counter-Receptor B7.2, FUN-1, CD86, CD28LG2;Description:Recombinant Human CD86 Protein is produced in Human Cells and the target gene encoding Ala24-Pro247 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSF DSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYI NLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFC ILETDKTRLLSSPFSIELEDPQPPPDHIPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human B7-2/CD86 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human B7-2/CD86 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human B7-2/CD86 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Human B7-2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD86 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;