Cat#:RPH-NP134;Product Name:Recombinant Human Fibroblast Growth Factor 2 / FGF2 / FGFb Protein(Pro143-Ser288);Synonym:Fibroblast growth factor 2,FGF-2,Basic fibroblast growth factor,bFGF,Heparin-binding growth factor 2,HBGF-2;Description:Recombinant Human Fibroblast growth factor 2 Protein is produced in E.coli and the target gene encoding Pro143-Ser288 is expressed.;Source:E.coli;AA Sequence:PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSI KGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKT GPGQKAILFLPMSAKS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fibroblast Growth Factor 2/FGF2/FGFb Protein (Pro143-Ser288)was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Fibroblast Growth Factor 2/FGF2/FGFb Protein (Pro143-Ser288)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human FGF2 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human FGF2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human FGF2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;