Cat#:FPA-077P;Product Name:Rabbit Anti-14-3-3 zeta Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human 14-3-3 zeta aa 200-245 (C terminal). (NP_003397.1) Sequence: IAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN ;Species Reactivity:Mouse, Rat, Human Predicted to work with: Sheep, Chicken, Cow, Xenopus laevis, Orangutan, Xenopus tropicalis;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;